PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00909.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 55aa    MW: 6302.11 Da    PI: 4.3998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00909.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM59.41.2e-18552149
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                             lppGfrFhPtdeel+++yL++kv+++ ++  +++ +vd++k+ePwdLp 
  Rsa1.0_00909.1_g00009.1  5 LPPGFRFHPTDEELITQYLCRKVSDTGFTG-KAVVDVDLNKCEPWDLPG 52
                             79*************************999.88**************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-19354IPR003441NAC domain
PROSITE profilePS5100520.425555IPR003441NAC domain
PfamPF023659.7E-9648IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
MEEKLPPGFR FHPTDEELIT QYLCRKVSDT GFTGKAVVDV DLNKCEPWDL PGNYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-155511763NO APICAL MERISTEM PROTEIN
1ut4_B9e-155511763NO APICAL MERISTEM PROTEIN
1ut7_A9e-155511763NO APICAL MERISTEM PROTEIN
1ut7_B9e-155511763NO APICAL MERISTEM PROTEIN
3swm_A1e-145512066NAC domain-containing protein 19
3swm_B1e-145512066NAC domain-containing protein 19
3swm_C1e-145512066NAC domain-containing protein 19
3swm_D1e-145512066NAC domain-containing protein 19
3swp_A1e-145512066NAC domain-containing protein 19
3swp_B1e-145512066NAC domain-containing protein 19
3swp_C1e-145512066NAC domain-containing protein 19
3swp_D1e-145512066NAC domain-containing protein 19
4dul_A9e-155511763NAC domain-containing protein 19
4dul_B9e-155511763NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266583e-54AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24.
GenBankCP0026863e-54CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639938.11e-29PREDICTED: NAC domain-containing protein 100
SwissprotO040173e-21NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A078JQF74e-30A0A078JQF7_BRANA; BnaCnng60050D protein (Fragment)
STRINGBra022319.1-P8e-29(Brassica rapa)
STRINGAT3G18400.19e-29(Arabidopsis thaliana)
STRINGAl_scaffold_0003_19421e-28(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-32NAC domain containing protein 58